MCHR1 Antibody (3D7)

Images

 
Western Blot: MCHR1 Antibody (3D7) [H00002847-M01] - GPR24 monoclonal antibody (M01), clone 3D7 Analysis of GPR24 expression in HL-60.
Sandwich ELISA: MCHR1 Antibody (3D7) [H00002847-M01] - Detection limit for recombinant GST tagged GPR24 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3D7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MCHR1 Antibody (3D7) Summary

Immunogen
GPR24 (AAH01736, 14 a.a. - 113 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VGLGGGSGCQATEEDPLPDCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMP
Localization
Integral membrane protein
Specificity
GPR24 - G protein-coupled receptor 24
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MCHR1
Purity
Ascites
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Ascites

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MCHR1 Antibody (3D7)

  • G protein-coupled receptor 24
  • GPR24
  • GPR24SLC-1
  • G-protein coupled receptor 24
  • MCH receptor 1
  • MCH1R
  • MCH-1R
  • MCH1RMCHR-1
  • MCHR1
  • MCH-R1
  • melanin-concentrating hormone receptor 1
  • MGC32129
  • SLC1
  • SLC1MCHR
  • Somatostatin receptor-like protein

Background

The protein encoded by this gene, a member of the G protein-coupled receptor family 1, is an integral plasma membrane protein which binds melanin-concentrating hormone. The encoded protein can inhibit cAMP accumulation and stimulate intracellular calcium flux, and is probably involved in the neuronal regulation of food consumption. Although structurally similar to somatostatin receptors, this protein does not seem to bind somatostatin.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13780
Species: Hu
Applications: IHC, IHC-P
NLS418
Species: Hu
Applications: IHC-P
MAB8458
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP1-02658
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
H00441931-R02
Species: Hu
NBP1-84903
Species: Hu
Applications: WB, IHC, IHC-P
H00442206-R02
Species: Hu
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
MAB2358
Species: Hu, Mu
Applications: IHC, ICC

Publications for MCHR1 Antibody (H00002847-M01) (0)

There are no publications for MCHR1 Antibody (H00002847-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MCHR1 Antibody (H00002847-M01) (0)

There are no reviews for MCHR1 Antibody (H00002847-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MCHR1 Antibody (H00002847-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MCHR1 Products

Bioinformatics Tool for MCHR1 Antibody (H00002847-M01)

Discover related pathways, diseases and genes to MCHR1 Antibody (H00002847-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MCHR1 Antibody (H00002847-M01)

Discover more about diseases related to MCHR1 Antibody (H00002847-M01).
 

Pathways for MCHR1 Antibody (H00002847-M01)

View related products by pathway.

PTMs for MCHR1 Antibody (H00002847-M01)

Learn more about PTMs related to MCHR1 Antibody (H00002847-M01).
 

Research Areas for MCHR1 Antibody (H00002847-M01)

Find related products by research area.

Blogs on MCHR1

There are no specific blogs for MCHR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MCHR1 Antibody (3D7) and receive a gift card or discount.

Bioinformatics

Gene Symbol MCHR1
Entrez
OMIM
Uniprot