MBD3L3 Antibody


Immunohistochemistry: MBD3L3 Antibody [NBP2-46787] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

MBD3L3 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MGEPAFTSFPSPPVLGKLKRNMMPWALQKKREIHMAKAHRRRAARSALPMRLTSCIFRRPVTRIRSHPDNQV
Specificity of human MBD3L3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MBD3L3 Recombinant Protein Antigen (NBP2-46787PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MBD3L3 Antibody (NBP2-46787) (0)

There are no publications for MBD3L3 Antibody (NBP2-46787).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MBD3L3 Antibody (NBP2-46787) (0)

There are no reviews for MBD3L3 Antibody (NBP2-46787). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MBD3L3 Antibody (NBP2-46787) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional MBD3L3 Products

Array NBP2-46787

Bioinformatics Tool for MBD3L3 Antibody (NBP2-46787)

Discover related pathways, diseases and genes to MBD3L3 Antibody (NBP2-46787). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on MBD3L3

There are no specific blogs for MBD3L3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MBD3L3 Antibody and receive a gift card or discount.


Gene Symbol MBD3L3