![Immunocytochemistry/Immunofluorescence: C7orf43 Antibody [NBP1-83808] - Staining of human cell line U-251 MG shows positivity in vesicles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/C7orf43-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83808-img0002.jpg "Immunocytochemistry/Immunofluorescence: C7orf43 Antibody [NBP1-83808] - Staining of human cell line U-251 MG shows positivity in vesicles. Antibody staining is shown in green.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, IHC-P, IP |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LRTGLFELSQHMKLKLQFTASVSHPPPEARPLSRKSSPSSPAVRDLVERHQASLGRSQSFSHQQPSRSHLMRSGSVMERRAITPPVASPVGRPLYLPPDKAVLSLDKIAKRECKVLVVE |
| Predicted Species | Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | C7ORF43 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. Use in Immunoprecipitation and Western blot reported in scientific literature (PMID:31467083). |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-83808 | Applications | Species |
|---|---|---|
| Cuenca A, Insinna C, Zhao H et al. The C7orf43/TRAPPC14 component links the TRAPPII complex to RABIN8 for preciliary vesicle tethering at the mother centriole during ciliogenesis J. Biol. Chem. Aug 29 2019 [PMID: 31467083] (IP, WB, Human) | IP, WB | Human |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | C7ORF43 |
![Immunohistochemistry-Paraffin: C7orf43 Antibody [NBP1-83808] - Staining of human esophagus shows strong cytoplasmic positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize2/C7orf43-Antibody-Immunohistochemistry-Paraffin-NBP1-83808-img0001.jpg "Immunohistochemistry-Paraffin: C7orf43 Antibody [NBP1-83808] - Staining of human esophagus shows strong cytoplasmic positivity in squamous epithelial cells.")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](http://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")