MAGEA8 Antibody - BSA Free

Immunohistochemistry-Paraffin: MAGEA8 Antibody [NBP1-92097] - Staining in human placenta and prostate tissues using anti-MAGEA8 antibody. Corresponding MAGEA8 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: MAGEA8 Antibody [NBP1-92097] - Staining of human placenta shows high expression.

Immunohistochemistry-Paraffin: MAGEA8 Antibody [NBP1-92097] - Staining of human prostate shows low expression as expected.

Staining of human skeletal muscle shows no positivity in myocytes as expected.

Staining of human placenta shows strong nuclear positivity in trophoblastic cells.

Staining of human prostate shows no positivity in glandular cells as expected.

Analysis in human placenta and prostate tissues using NBP1-92097 antibody. Corresponding MAGEA8 RNA-seq data are presented for the same tissues.

Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MAGEA8 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MAGEA8 Antibody - BSA Free (NBP1-92097) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AQGEAPGLMDVQIPTAEEQKAASSSSTLIMGTLEEVTDSGSPSPPQSPEGASSSLTVTDSTLWSQSDEGSSSNEEEGPSTSPDPAHLESLFREALDEKVAELVRFLLRKYQIKEPVTKAEMLESVI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MAGEA8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  MAGEA8 Protein (NBP1-92097PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MAGEA8 Antibody - BSA Free

• Cancer/testis antigen 1.8
• CT1.8MAGE-8 antigen
• MAGE8cancer/testis antigen family 1, member 8
• melanoma antigen family A, 8
• melanoma-associated antigen 8
• MGC2182

Background

The MAGEA genes are expressed at a high level in a number of tumors of various histologic types, and are silent in normal tissues with the exception of testis and placenta. The MAGEA genes are clustered on chromosome Xq28. They may be implicated in some hereditary disorders, such as dyskeratosis congenita.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MAGEA8