LYRM7 Antibody

Images

 
Western Blot: LYRM7 Antibody [NBP2-14701] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: LYRM7 Antibody [NBP2-14701] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LYRM7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KTLHRTRQQVFKNDARALEAARIKINEEFKNNKSETSSKKIEELMKIGSD VELLLRTSVIQGIHTDHNTLKLVPRKDLLVENVPYCDAPTQKQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LYRM7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500 - 1:1000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LYRM7 Protein (NBP2-14701PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (85%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LYRM7 Antibody

  • C5orf31
  • LYRM7 Lyrm7 homolog (mouse)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LYRM7 Antibody (NBP2-14701) (0)

There are no publications for LYRM7 Antibody (NBP2-14701).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LYRM7 Antibody (NBP2-14701) (0)

There are no reviews for LYRM7 Antibody (NBP2-14701). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LYRM7 Antibody (NBP2-14701). (Showing 1 - 1 of 1 FAQ).

  1. What is the concentration for the lot# 59984 of NBP2-14701?
    • NBP2-14701, lot R59984, is supplied at 0.2mg/ml.

Secondary Antibodies

 

Isotype Controls

Additional LYRM7 Products

LYRM7 NBP2-14701

Bioinformatics Tool for LYRM7 Antibody (NBP2-14701)

Discover related pathways, diseases and genes to LYRM7 Antibody (NBP2-14701). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on LYRM7

There are no specific blogs for LYRM7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LYRM7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LYRM7