LYDG10 Antibody


Immunocytochemistry/ Immunofluorescence: LYDG10 Antibody [NBP2-56204] - Staining of human cell line PC-3 shows localization to nucleus & nucleoli.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF

Order Details

LYDG10 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GQRKFQAHKPAKSKTAAAASEKNRGPRKGGRVIAPRKARVVQQQ
Specificity of human LYDG10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for LYDG10 Antibody

  • C19orf53
  • chromosome 19 open reading frame 53
  • HSPC023
  • leydig cell tumor 10 kDa protein homolog
  • LYDG10


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LYDG10 Antibody (NBP2-56204) (0)

There are no publications for LYDG10 Antibody (NBP2-56204).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LYDG10 Antibody (NBP2-56204) (0)

There are no reviews for LYDG10 Antibody (NBP2-56204). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for LYDG10 Antibody (NBP2-56204) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional LYDG10 Products

Bioinformatics Tool for LYDG10 Antibody (NBP2-56204)

Discover related pathways, diseases and genes to LYDG10 Antibody (NBP2-56204). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on LYDG10

There are no specific blogs for LYDG10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our LYDG10 Antibody and receive a gift card or discount.


Gene Symbol C19ORF53