LURAP1L Antibody

Images

 
Western Blot: C9orf150 Antibody [NBP1-90796] - Analysis in control (vector only transfected HEK293T lysate) and LURAP1L over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunocytochemistry/ Immunofluorescence: C9orf150 Antibody [NBP1-90796] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoli.
Immunohistochemistry-Paraffin: C9orf150 Antibody [NBP1-90796] - Staining of human testis shows strong cytoplasmic positivity in cells of seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LURAP1L Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KVPESLVRSLRGEEPVPRERDRDPCGGSGGGGGGGGGCSSSSSYCSFPPSLSSSSSSSPTSGSPRGSHSSALERLETKLHLLRQEMVNLRATDVRLMRQLLVINESIESIKW
Specificity
Specificity of human C9orf150 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LURAP1L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LURAP1L Recombinant Protein Antigen (NBP1-90796PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LURAP1L Antibody

  • bA3L8.2
  • C9orf150
  • chromosome 9 open reading frame 150
  • HYST0841
  • leucine rich adaptor protein 1-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LURAP1L Antibody (NBP1-90796) (0)

There are no publications for LURAP1L Antibody (NBP1-90796).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LURAP1L Antibody (NBP1-90796) (0)

There are no reviews for LURAP1L Antibody (NBP1-90796). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LURAP1L Antibody (NBP1-90796) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional LURAP1L Products

Bioinformatics Tool for LURAP1L Antibody (NBP1-90796)

Discover related pathways, diseases and genes to LURAP1L Antibody (NBP1-90796). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on LURAP1L

There are no specific blogs for LURAP1L, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LURAP1L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LURAP1L