![Western Blot: LRRN4CL Antibody [NBP2-30871] - Analysis in control (vector only transfected HEK293T lysate) and LRRN4CL over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize2/LRRN4CL-Antibody-Western-Blot-NBP2-30871-img0006.jpg "Western Blot: LRRN4CL Antibody [NBP2-30871] - Analysis in control (vector only transfected HEK293T lysate) and LRRN4CL over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QDFEEEEADETETAWPPLPAVPCDYDHCRHLQVPCKELQRVGPAACLCPGLSSPAQPPDPPRMGEVRIAAEEGRAVVHWCA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | LRRN4CL |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: LRRN4CL Antibody [NBP2-30871] - Staining of human cell line BJ shows localization to nucleoplasm.](http://images.novusbio.com/fullsize2/LRRN4CL-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-30871-img0002.jpg "Immunocytochemistry/Immunofluorescence: LRRN4CL Antibody [NBP2-30871] - Staining of human cell line BJ shows localization to nucleoplasm.")
![Immunohistochemistry-Paraffin: LRRN4CL Antibody [NBP2-30871] - Staining in human endometrium and kidney tissues using anti-LRRN4CL antibody. Corresponding LRRN4CL RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/LRRN4CL-Antibody-Immunohistochemistry-Paraffin-NBP2-30871-img0005.jpg "Immunohistochemistry-Paraffin: LRRN4CL Antibody [NBP2-30871] - Staining in human endometrium and kidney tissues using anti-LRRN4CL antibody. Corresponding LRRN4CL RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: LRRN4CL Antibody [NBP2-30871] - Staining of human endometrium shows high expression.](http://images.novusbio.com/fullsize2/LRRN4CL-Antibody-Immunohistochemistry-Paraffin-NBP2-30871-img0003.jpg "Immunohistochemistry-Paraffin: LRRN4CL Antibody [NBP2-30871] - Staining of human endometrium shows high expression.")
![Immunohistochemistry-Paraffin: LRRN4CL Antibody [NBP2-30871] - Staining of human kidney shows low expression as expected.](http://images.novusbio.com/fullsize2/LRRN4CL-Antibody-Immunohistochemistry-Paraffin-NBP2-30871-img0004.jpg "Immunohistochemistry-Paraffin: LRRN4CL Antibody [NBP2-30871] - Staining of human kidney shows low expression as expected.")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")