LRRC57 Antibody


Western Blot: LRRC57 Antibody [NBP1-83485] - Analysis in control (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry: LRRC57 Antibody [NBP1-83485] - Staining of human cell line A-431 shows positivity in mitochondria.
Immunohistochemistry-Paraffin: LRRC57 Antibody [NBP1-83485] - Staining of human stomach, upper shows strong cytoplasmic and membrane positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

LRRC57 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: ESLPPLLIGKFTLLKSLSLNNNKLTVLPDEICNLKKLETLSLNNNHLRELPSTFGQLSALKTL
Specificity of human LRRC57 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (94%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LRRC57 Protein (NBP1-83485PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for LRRC57 Antibody

  • DKFZp686H1865
  • FLJ36812
  • leucine rich repeat containing 57
  • leucine-rich repeat-containing protein 57


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LRRC57 Antibody (NBP1-83485) (0)

There are no publications for LRRC57 Antibody (NBP1-83485).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRRC57 Antibody (NBP1-83485) (0)

There are no reviews for LRRC57 Antibody (NBP1-83485). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LRRC57 Antibody (NBP1-83485) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional LRRC57 Products

Bioinformatics Tool for LRRC57 Antibody (NBP1-83485)

Discover related pathways, diseases and genes to LRRC57 Antibody (NBP1-83485). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on LRRC57

There are no specific blogs for LRRC57, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our LRRC57 Antibody and receive a gift card or discount.


Gene Symbol LRRC57