LRRC55 Antibody - BSA Free

Immunohistochemistry-Paraffin: LRRC55 Antibody [NBP1-81890] - Staining of human cerebellum shows moderate positivity in neuropil.

Immunohistochemistry-Paraffin: LRRC55 Antibody [NBP1-81890] - Staining of human kidney shows strong membranous positivity in cells in glomeruli.

Immunohistochemistry-Paraffin: LRRC55 Antibody [NBP1-81890] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: LRRC55 Antibody [NBP1-81890] -Staining of human small intestine shows moderate apical membrane positivity in glandular cells, as well as moderate immunoreactivity in the peripheral ganglion cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

LRRC55 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit LRRC55 Antibody - BSA Free (NBP1-81890) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RLAHLDLSYNNFSHVPADMFQEAHGLVHIDLSHNPWLRRVHPQAFQGLMQLRDLDLSYGGLAFLSLEALEGLPGLVTLQIGGNPWVCGCTMEPLLKWLRNRIQRCTADSQ
• Predicted Species: Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LRRC55
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  LRRC55 Protein (NBP1-81890PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for LRRC55 Antibody - BSA Free

• DKFZp667D0425
• FLJ13339
• FLJ45686
• leucine rich repeat containing 55
• leucine-rich repeat-containing protein 55
• LRRC55

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Review for LRRC55 Antibody (NBP1-81890) (1)

Average Rating: 1

(Based on 1 review)

We have 1 review tested in 1 species: Mouse.

reviewed by: Ping Dong IHC-Fr Mouse 06/17/2021

Summary

• Application: Immunohistochemistry-Frozen
• Sample Tested: Adult mouse brain tissue
• Species: Mouse
• Lot: A104418

Comments

• Comments: ***Bio-Techne Response: This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.*** 1. Wash in PBS 10min x 3 2. Incubation in 5% goat serum and 0.3% Triton X-100 for 2h at RT 3. 5% goat serum and 0.3% Triton X-100 4. Rabbit Polyclonal LRRC55 Antibody (1:50) 5. Goat anti-rabbit 488 6. PBS 10min x 3 7. DAPI 5min at RT 8. PBS 10min x 3 Mice were transcardially perfused with phosphate-buffered saline (PBS) followed by 4% paraformaldehyde. The brain was removed and post-fixed in 4% paraformaldehyde overnight at 4°C and dehydrated in 30% sucrose for 48 h. Coronal section (50 μm) containing the medial habenula were collected using a cryostat. The sections were rinsed 3 times with PBS for 10 min each and blocked with 5% goat serum and 0.3% Triton X-100 for 2 hours at room temperature and incubated for overnight at 4°C with following primary antibodies: anti-Lrrc55 (1:50, NBP1-81890-25UL). After 3 rinses with PBS for 10 min, secondary antibodies (1:1000, conjugated with Alexa 594) were incubated for 2 hours at room temperature. Then the sections were washed 3 times with PBS for 10 min each and stained with DAPI (1:10000 of 5 mg/mL). Images were acquired using a Zeiss 780 inverted confocal microscope.

Bioinformatics

• Gene Symbol: LRRC55