LRRC3C Antibody

Images

 
Immunohistochemistry: LRRC3C Antibody [NBP2-49651] - Staining of human endometrium shows strong cytoplasmic positivity in cells in endometrial stroma.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LRRC3C Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: YVWQNRDETRRSLKRAPVLPVRSEDSSILSTVV
Specificity
Specificity of human LRRC3C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LRRC3C
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LRRC3C Recombinant Protein Antigen (NBP2-49651PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LRRC3C Antibody

  • Leucine Rich Repeat Containing 3C

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LRRC3C Antibody (NBP2-49651) (0)

There are no publications for LRRC3C Antibody (NBP2-49651).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRRC3C Antibody (NBP2-49651) (0)

There are no reviews for LRRC3C Antibody (NBP2-49651). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for LRRC3C Antibody (NBP2-49651) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional LRRC3C Products

Array NBP2-49651

Bioinformatics Tool for LRRC3C Antibody (NBP2-49651)

Discover related pathways, diseases and genes to LRRC3C Antibody (NBP2-49651). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on LRRC3C

There are no specific blogs for LRRC3C, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LRRC3C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LRRC3C