LRRC37B Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: LRRC37B Antibody [NBP1-91094] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: LRRC37B Antibody [NBP1-91094] - Staining of human testis shows cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LRRC37B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PFLAAHQDLNDKRTPEERLPEVVPLLNRDQNQALVQLPRLKWVQTTDLDRAAGHQADEILVPLDSKVSRPTKFVVSPKNLKKDLAERWSLPEIVGIPH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LRRC37B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LRRC37B Protein (NBP1-91094PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LRRC37B Antibody

  • C66 SLIT-like testicular protein
  • leucine rich repeat containing 37B
  • leucine-rich repeat-containing protein 37B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LRRC37B Antibody (NBP1-91094) (0)

There are no publications for LRRC37B Antibody (NBP1-91094).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRRC37B Antibody (NBP1-91094) (0)

There are no reviews for LRRC37B Antibody (NBP1-91094). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for LRRC37B Antibody (NBP1-91094) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LRRC37B Products

Bioinformatics Tool for LRRC37B Antibody (NBP1-91094)

Discover related pathways, diseases and genes to LRRC37B Antibody (NBP1-91094). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRRC37B Antibody (NBP1-91094)

Discover more about diseases related to LRRC37B Antibody (NBP1-91094).
 

Pathways for LRRC37B Antibody (NBP1-91094)

View related products by pathway.

Blogs on LRRC37B

There are no specific blogs for LRRC37B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LRRC37B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LRRC37B