LRRC34 Antibody

Immunocytochemistry/ Immunofluorescence: LRRC34 Antibody [NBP1-81146] - Staining of human cell line U-2 OS shows positivity in cytoskeleton (microtubules).
Immunohistochemistry-Paraffin: LRRC34 Antibody [NBP1-81146] - Staining of human fallopian tube shows strong cytoplasmic and membrane positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Order Details

LRRC34 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:LHILQEVDEEIKKGLAAGITLNIAGNNRLVPVERVTGEDFWILSKILKNCLYINGLDVGYNLLCDVGAYYAAKLLQKQ
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, pH 7.2, containing 40% glycerol
0.02% Sodium Azide
Immunogen affinity purified

  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
LRRC34 Protein (NBP1-81146PEP)

Reactivity Notes

Expeced cross reactivity based on sequence identity: Mouse (64%), Rat (64%).

Alternate Names for LRRC34 Antibody

  • FLJ27346
  • leucine rich repeat containing 34
  • leucine-rich repeat-containing protein 34
  • MGC27085

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, Flow, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for LRRC34 Antibody (NBP1-81146) (0)

There are no publications for LRRC34 Antibody (NBP1-81146).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRRC34 Antibody (NBP1-81146) (0)

There are no reviews for LRRC34 Antibody (NBP1-81146). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for LRRC34 Antibody (NBP1-81146) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

Isotype Controls

Additional LRRC34 Antibody Products

Related Products by Gene

Bioinformatics Tool for LRRC34 Antibody (NBP1-81146)

Discover related pathways, diseases and genes to LRRC34 Antibody (NBP1-81146). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for LRRC34 Antibody (NBP1-81146)

View related products by pathway.

Blogs on LRRC34

There are no specific blogs for LRRC34, but you can read our latest blog posts.

Contact Information

Product PDFs

Gene Symbol LRRC34

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-81146 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought