LRRC34 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: LRRC34 Antibody [NBP1-81146] - Immunofluorescent staining of human cell line U-2 OS shows localization to microtubules, cytokinetic bridge & cell junctions.
Immunohistochemistry-Paraffin: LRRC34 Antibody [NBP1-81146] - Staining of human fallopian tube shows strong cytoplasmic and membrane positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LRRC34 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LHILQEVDEEIKKGLAAGITLNIAGNNRLVPVERVTGEDFWILSKILKNCLYINGLDVGYNLLCDVGAYYAAKLLQKQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LRRC34
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LRRC34 Protein (NBP1-81146PEP)

Reactivity Notes

Expeced cross reactivity based on sequence identity: Mouse (64%), Rat (64%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LRRC34 Antibody

  • FLJ27346
  • leucine rich repeat containing 34
  • leucine-rich repeat-containing protein 34
  • MGC27085

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37463
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP1-81146
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for LRRC34 Antibody (NBP1-81146) (0)

There are no publications for LRRC34 Antibody (NBP1-81146).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRRC34 Antibody (NBP1-81146) (0)

There are no reviews for LRRC34 Antibody (NBP1-81146). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for LRRC34 Antibody (NBP1-81146) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LRRC34 Products

Bioinformatics Tool for LRRC34 Antibody (NBP1-81146)

Discover related pathways, diseases and genes to LRRC34 Antibody (NBP1-81146). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for LRRC34 Antibody (NBP1-81146)

View related products by pathway.

Blogs on LRRC34

There are no specific blogs for LRRC34, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LRRC34 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LRRC34