LRP5L Antibody


Western Blot: LRP5L Antibody [NBP1-90543] - Analysis in control (vector only transfected HEK293T lysate) and LRP5L over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: LRP5L Antibody [NBP1-90543] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: LRP5L Antibody [NBP1-90543] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

LRP5L Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: VIIDQLPDLMGLKAVNVDKVVGTNPHADRNGGAATCASSRPTQPGLAAPSRAWN
Specificity of human LRP5L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Human Bone Marrow Whole Tissue Lysate (Adult Whole Diabetes)
Control Peptide

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for LRP5L Antibody

  • low density lipoprotein receptor-related protein 5-like
  • LRP-5-like


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LRP5L Antibody (NBP1-90543) (0)

There are no publications for LRP5L Antibody (NBP1-90543).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRP5L Antibody (NBP1-90543) (0)

There are no reviews for LRP5L Antibody (NBP1-90543). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LRP5L Antibody (NBP1-90543) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional LRP5L Products

Bioinformatics Tool for LRP5L Antibody (NBP1-90543)

Discover related pathways, diseases and genes to LRP5L Antibody (NBP1-90543). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on LRP5L

There are no specific blogs for LRP5L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our LRP5L Antibody and receive a gift card or discount.


Gene Symbol LRP5L