LRCH3 Antibody

Images

 
Western Blot: LRCH3 Antibody [NBP1-81083] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/ Immunofluorescence: LRCH3 Antibody [NBP1-81083] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemistry-Paraffin: LRCH3 Antibody [NBP1-81083] - Staining of human tonsil shows moderate cytoplasmic positivity in germinal center cells.
Western Blot: LRCH3 Antibody [NBP1-81083] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: LRCH3 Antibody [NBP1-81083] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: LRCH3 Antibody [NBP1-81083] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: LRCH3 Antibody [NBP1-81083] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LRCH3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: HASPLPPSAAPTTDSTDSITGQNSRQREEELELIDQLRKHIEYRLKVSLPCDLGAALTDGVVLCHLANHVRPRSVPSIHVPSP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LRCH3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LRCH3 Protein (NBP1-81083PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LRCH3 Antibody

  • FLJ20994
  • FLJ43245
  • FLJ44976,2210409B11Rik
  • leucine-rich repeat and calponin homology domain-containing protein 3
  • leucine-rich repeats and calponin homology (CH) domain containing 3
  • MGC4126

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-94455
Species: Hu, Mu, Rt
Applications: WB
NBP1-84366
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00131540-P01
Species: Hu
Applications: ELISA, AP, PA, WB
AF6990
Species: Mu
Applications: ICC, WB
NBP2-24528
Species: Ca, Eq, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NBP2-42526
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP1-52193
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-24566
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-32311
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NB200-585
Species: Mu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-57085
Species: Hu, Rt
Applications: WB
NBP1-81083
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for LRCH3 Antibody (NBP1-81083) (0)

There are no publications for LRCH3 Antibody (NBP1-81083).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRCH3 Antibody (NBP1-81083) (0)

There are no reviews for LRCH3 Antibody (NBP1-81083). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LRCH3 Antibody (NBP1-81083) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional LRCH3 Products

Bioinformatics Tool for LRCH3 Antibody (NBP1-81083)

Discover related pathways, diseases and genes to LRCH3 Antibody (NBP1-81083). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRCH3 Antibody (NBP1-81083)

Discover more about diseases related to LRCH3 Antibody (NBP1-81083).

Blogs on LRCH3

There are no specific blogs for LRCH3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LRCH3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LRCH3
Entrez