LOC729420 Antibody


Immunohistochemistry-Paraffin: LOC729420 Antibody [NBP2-14754] Staining of human kidney shows moderate membranous positivity in glomeruli.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

LOC729420 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MTWLDKGVWTQEDENSCSFSESDFPGCRDQINPSIPSIWTAVSGMMISLE VRWWIKGKQGYVISLGHA
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LOC729420 Protein (NBP2-14754PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for LOC729420 Antibody

  • LOC729420 uncharacterized LOC729420


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LOC729420 Antibody (NBP2-14754) (0)

There are no publications for LOC729420 Antibody (NBP2-14754).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LOC729420 Antibody (NBP2-14754) (0)

There are no reviews for LOC729420 Antibody (NBP2-14754). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for LOC729420 Antibody (NBP2-14754) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional LOC729420 Products

LOC729420 NBP2-14754

Bioinformatics Tool for LOC729420 Antibody (NBP2-14754)

Discover related pathways, diseases and genes to LOC729420 Antibody (NBP2-14754). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on LOC729420

There are no specific blogs for LOC729420, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our LOC729420 Antibody and receive a gift card or discount.


Gene Symbol C13orf45