LMO7 Downstream Neighbor Antibody

Images

 
Immunohistochemistry-Paraffin: LOC729420 Antibody [NBP2-14754] Staining of human kidney shows moderate membranous positivity in glomeruli.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LMO7 Downstream Neighbor Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: MTWLDKGVWTQEDENSCSFSESDFPGCRDQINPSIPSIWTAVSGMMISLEVRWWIKGKQGYVISLGHA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C13orf45
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LMO7 Downstream Neighbor Recombinant Protein Antigen (NBP2-14754PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LMO7 Downstream Neighbor Antibody

  • LOC729420 uncharacterized LOC729420

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LMO7 Downstream Neighbor Antibody (NBP2-14754) (0)

There are no publications for LMO7 Downstream Neighbor Antibody (NBP2-14754).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LMO7 Downstream Neighbor Antibody (NBP2-14754) (0)

There are no reviews for LMO7 Downstream Neighbor Antibody (NBP2-14754). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for LMO7 Downstream Neighbor Antibody (NBP2-14754) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LMO7 Downstream Neighbor Products

Blogs on LMO7 Downstream Neighbor

There are no specific blogs for LMO7 Downstream Neighbor, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LMO7 Downstream Neighbor Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C13orf45