LINGO3 Antibody


Immunohistochemistry: LINGO3 Antibody [NBP2-30622] - Staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

LINGO3 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: LWIVQRRKTLNFDGRLPACATPAEVRGDALRNLPDSVLFEYFVCRKPKIRERRLQRVTATAGEDVRFLCR
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LINGO3 Protein (NBP2-30622PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for LINGO3 Antibody

  • hCG2040376
  • LERN2
  • Leucine Rich Repeat And Ig Domain Containing 3
  • Leucine Rich Repeat Neuronal 6B
  • Leucine-Rich Repeat And Immunoglobulin-Like Domain-Containing Nogo
  • Leucine-Rich Repeat Neuronal Protein 2
  • Leucine-Rich Repeat Neuronal Protein 6B
  • LINGO3
  • LINGO-3
  • LRRN6B


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, WB
Species: Hu
Applications: CyTOF-ready, Flow, WB

Publications for LINGO3 Antibody (NBP2-30622) (0)

There are no publications for LINGO3 Antibody (NBP2-30622).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LINGO3 Antibody (NBP2-30622) (0)

There are no reviews for LINGO3 Antibody (NBP2-30622). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for LINGO3 Antibody (NBP2-30622) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional LINGO3 Products

Bioinformatics Tool for LINGO3 Antibody (NBP2-30622)

Discover related pathways, diseases and genes to LINGO3 Antibody (NBP2-30622). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on LINGO3

There are no specific blogs for LINGO3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our LINGO3 Antibody and receive a gift card or discount.


Gene Symbol LINGO3