![Immunocytochemistry/Immunofluorescence: LIAT1 Antibody [NBP1-81295] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoli.](http://images.novusbio.com/fullsize2/LIAT1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-81295-img0006.jpg "Immunocytochemistry/Immunofluorescence: LIAT1 Antibody [NBP1-81295] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoli.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ICC/IF, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SKVEKKHLPSDSSTVSLPDFAEIENLANRINESLRWDGILADPEAEKERIRIYKLNRRKRYRCLALKGFHPDPEALKGFHPDPEALKGFHPDP |
| Specificity | Specificity of human C17orf97 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | C17orf97 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | WB reported in scientific literature (PMID: 25369936). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-81295 | Applications | Species |
|---|---|---|
| Brower CS, Rosen CE, Jones RH et al. Liat1, an arginyltransferase-binding protein whose evolution among primates involved changes in the numbers of its 10-residue repeats. Proc Natl Acad Sci U S A 2014 Nov 18 [PMID: 25369936] (WB, Mouse, Human) | WB | Mouse, Human |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | C17orf97 |
![Immunohistochemistry: LIAT1 Antibody [NBP1-81295] - Staining of human testis shows strong cytoplasmic positivity in subsets of seminiferus duct cells.](http://images.novusbio.com/fullsize2/LIAT1-Antibody-Immunohistochemistry-NBP1-81295-img0007.jpg "Immunohistochemistry: LIAT1 Antibody [NBP1-81295] - Staining of human testis shows strong cytoplasmic positivity in subsets of seminiferus duct cells.")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0006.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.")