LIAT1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: LIAT1 Antibody [NBP1-81295] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoli.
Immunohistochemistry: LIAT1 Antibody [NBP1-81295] - Staining of human testis shows strong cytoplasmic positivity in subsets of seminiferus duct cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LIAT1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SKVEKKHLPSDSSTVSLPDFAEIENLANRINESLRWDGILADPEAEKERIRIYKLNRRKRYRCLALKGFHPDPEALKGFHPDPEALKGFHPDP
Specificity
Specificity of human C17orf97 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C17orf97
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
WB reported in scientific literature (PMID: 25369936). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LIAT1 Recombinant Protein Antigen (NBP1-81295PEP)
Publications
Read Publication using
NBP1-81295 in the following applications:

  • WB
    1 publication

Reactivity Notes

Mouse, Human reactivity reported in scientific literature (PMID: 25369936).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LIAT1 Antibody

  • chromosome 17 open reading frame 97
  • hypothetical protein LOC400566

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LIAT1 Antibody (NBP1-81295)(1)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
Mouse
(1)
All Species

Reviews for LIAT1 Antibody (NBP1-81295) (0)

There are no reviews for LIAT1 Antibody (NBP1-81295). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LIAT1 Antibody (NBP1-81295) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional LIAT1 Products

Array NBP1-81295

Bioinformatics Tool for LIAT1 Antibody (NBP1-81295)

Discover related pathways, diseases and genes to LIAT1 Antibody (NBP1-81295). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on LIAT1

There are no specific blogs for LIAT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LIAT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C17orf97