Recombinant Human LCN9 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human LCN9 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 176 of Human LCN9 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MALLLLSLGLSLIAAQEFDPHTVMQRNYNVARVSGVWYSIFMASDDLNRIKENGDLRVFVRNIEHLKNGSLIFDFEYMVQGECVAVVVVCEKTEKNGEYSINYEGQNTVAVSETDYRLFITFHLQNFRNGTETHTLALYETCEKYGLGSQNIIDLTNKDPCYSKHYRSPPRPPMRW

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
LCN9

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human LCN9 Protein

  • lipocalin 9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1844
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-01696
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-235
Species: Hu, Mu, Po
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-56314
Species: Hu
Applications: WB
NBP2-22194
Species: Hu, Mu, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-34270
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP2-47649
Species: Hu
Applications: WB, Flow, IHC-P, PAGE, IF
NBP1-57957
Species: Hu
Applications: WB
NBP2-31878
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1457
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
H00392399-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for LCN9 Recombinant Protein (H00392399-P01) (0)

There are no publications for LCN9 Recombinant Protein (H00392399-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LCN9 Recombinant Protein (H00392399-P01) (0)

There are no reviews for LCN9 Recombinant Protein (H00392399-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LCN9 Recombinant Protein (H00392399-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LCN9 Products

LCN9 H00392399-P01

Bioinformatics Tool for LCN9 Recombinant Protein (H00392399-P01)

Discover related pathways, diseases and genes to LCN9 Recombinant Protein (H00392399-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LCN9 Recombinant Protein (H00392399-P01)

Discover more about diseases related to LCN9 Recombinant Protein (H00392399-P01).
 

Pathways for LCN9 Recombinant Protein (H00392399-P01)

View related products by pathway.

PTMs for LCN9 Recombinant Protein (H00392399-P01)

Learn more about PTMs related to LCN9 Recombinant Protein (H00392399-P01).

Blogs on LCN9

There are no specific blogs for LCN9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human LCN9 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol LCN9