Recombinant Human LCE1C Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human LCE1C Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 118 of Human LCE1C full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSCQQSQQQCQPPPKCTPKCPPKCPTPKCPPKCPPKCPPVSSCCSVSSGGCCGSSSGGSCGSSSGGCCSSGGGGCCLSHHRRRRSHCHRPQSSGCCSQPSGGSSCCGGGSGQHSGGCC

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
LCE1C

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human LCE1C Protein

  • late cornified envelope 1C
  • late cornified envelope protein 1C
  • late envelope protein 3
  • LEP3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP2-24603
Species: Hu, Mu, Pm
Applications: WB
NBP2-45978
Species: Hu
Applications: WB, Flow, IHC
NBP2-01506
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP

Publications for LCE1C Recombinant Protein (H00353133-P01) (0)

There are no publications for LCE1C Recombinant Protein (H00353133-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LCE1C Recombinant Protein (H00353133-P01) (0)

There are no reviews for LCE1C Recombinant Protein (H00353133-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LCE1C Recombinant Protein (H00353133-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LCE1C Products

LCE1C H00353133-P01

Bioinformatics Tool for LCE1C Recombinant Protein (H00353133-P01)

Discover related pathways, diseases and genes to LCE1C Recombinant Protein (H00353133-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LCE1C Recombinant Protein (H00353133-P01)

Discover more about diseases related to LCE1C Recombinant Protein (H00353133-P01).
 

Pathways for LCE1C Recombinant Protein (H00353133-P01)

View related products by pathway.

Blogs on LCE1C

There are no specific blogs for LCE1C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Bcl-xL Antibody
NB100-56104

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human LCE1C Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol LCE1C