Kv9.2 Antibody - BSA Free

Images

 
Western Blot: Kv9.2 Antibody [NBP3-10168] - Western blot analysis of Kv9.2 in Mouse Skeletal Muscle lysates. Antibody dilution at 1ug/ml

Product Details

Summary
Product Discontinued
View other related Kv9.2 Primary Antibodies

Order Details


    • Catalog Number
      NBP3-10168
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Kv9.2 Antibody - BSA Free Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse Kv9.2 (NP_001258633.1). Peptide sequence GINEFFIDSCCSYSYHGRKVEPEQEKWDEQSDQESTTSSFDEILAFYNDA
Clonality
Polyclonal
Host
Rabbit
Gene
KCNS2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for Kv9.2 Antibody - BSA Free

  • Delayed-rectifier K(+) channel alpha subunit 2
  • KIAA1144
  • KV9.2
  • potassium voltage-gated channel subfamily S member 2
  • potassium voltage-gated channel, delayed-rectifier, subfamily S, member 2
  • Voltage-gated potassium channel subunit Kv9.2

Background

Voltage-gated K+ channels in the plasma membrane control the repolarization and the frequency of action potentials in neurons, muscles and other excitable cells. The KV gene family encodes more than 30 proteins that comprise the subunits of the K+ channels, and they vary in their gating and permeation properties, subcellular distribution and expression patterns. Functional KV channels assemble as tetramers consisting of pore-forming alpha subunits (KV), which include the KV1, KV2, KV3, KV4 and KV9 proteins, and accessory or KV-subunits that modify the gating properties of the coexpressed KV subunits. KV9.2 is a K+ channel subunit that reduces the ion flow and regulates channel activity. It localizes to the cell membrane and, in the absence of KCNB1, KV9.2 may not reach the plasma membrane and may remain in an intracellular compartment.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38498
Species: Hu
Applications: IHC,  IHC-P
NBP1-81572
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB300-261
Species: Rt, Xp
Applications: IHC, IHC-Fr, WB
NBP2-62639
Species: Hu
Applications: IHC,  IHC-P
NBP1-81336
Species: Hu, In
Applications: IHC,  IHC-P, WB
NBP2-76939
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-18993
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP3-46349
Species: Hu, Mu, Rt
Applications: ELISA, WB

Publications for Kv9.2 Antibody (NBP3-10168) (0)

There are no publications for Kv9.2 Antibody (NBP3-10168).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kv9.2 Antibody (NBP3-10168) (0)

There are no reviews for Kv9.2 Antibody (NBP3-10168). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Kv9.2 Antibody (NBP3-10168) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Kv9.2 Products

Array NBP3-10168

Research Areas for Kv9.2 Antibody (NBP3-10168)

Find related products by research area.

Blogs on Kv9.2

There are no specific blogs for Kv9.2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Kv9.2 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNS2