KRBA1 Antibody

Images

 
Immunohistochemistry-Paraffin: KRBA1 Antibody [NBP1-81365] - Staining of human breast shows moderate positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KRBA1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: INCLKEILVPGPRHPETSPSFLPPLPSLGTSRLTRADLGPGSPPWAVKTEAVSGDCPLQGLLHCLKELPEAQDRHPSPSGVGNRRLQENPGAWKRGSGGPGYLLTPPPHPDLGAG
Specificity
Specificity of human KRBA1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KRBA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
KRBA1 Protein (NBP1-81365PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KRBA1 Antibody

  • KRAB-A domain containing 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for KRBA1 Antibody (NBP1-81365) (0)

There are no publications for KRBA1 Antibody (NBP1-81365).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KRBA1 Antibody (NBP1-81365) (0)

There are no reviews for KRBA1 Antibody (NBP1-81365). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for KRBA1 Antibody (NBP1-81365) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional KRBA1 Products

Array NBP1-81365

Bioinformatics Tool for KRBA1 Antibody (NBP1-81365)

Discover related pathways, diseases and genes to KRBA1 Antibody (NBP1-81365). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on KRBA1

There are no specific blogs for KRBA1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KRBA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KRBA1