KPRP Antibody


Immunocytochemistry/ Immunofluorescence: KPRP Antibody [NBP1-90707] - Staining of human cell line U-251MG shows positivity in plasma membrane and cytoplasm.
Immunohistochemistry-Paraffin: KPRP Antibody [NBP1-90707] - Staining of human skin shows high expression.
Immunohistochemistry-Paraffin: KPRP Antibody [NBP1-90707] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: KPRP Antibody [NBP1-90707] - Staining in human skin and skeletal muscle tissues using anti-KPRP antibody. Corresponding KPRP RNA-seq data are presented for the same tissues.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

KPRP Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: PNPVPYPGDLGCHESSPHRLDTEAPYCGPSSYNQGQESGAGCGPGDVFPERRGQDGHGDQGNAFAGVKGEAK
Specificity of human KPRP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
KPRP Protein (NBP1-90707PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for KPRP Antibody

  • C1orf45
  • hKPRP
  • keratinocyte expressed, proline-rich protein
  • keratinocyte proline-rich protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for KPRP Antibody (NBP1-90707) (0)

There are no publications for KPRP Antibody (NBP1-90707).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KPRP Antibody (NBP1-90707) (0)

There are no reviews for KPRP Antibody (NBP1-90707). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for KPRP Antibody (NBP1-90707) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional KPRP Products

KPRP NBP1-90707

Bioinformatics Tool for KPRP Antibody (NBP1-90707)

Discover related pathways, diseases and genes to KPRP Antibody (NBP1-90707). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KPRP Antibody (NBP1-90707)

Discover more about diseases related to KPRP Antibody (NBP1-90707).

Pathways for KPRP Antibody (NBP1-90707)

View related products by pathway.

Blogs on KPRP

There are no specific blogs for KPRP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our KPRP Antibody and receive a gift card or discount.


Gene Symbol KPRP