KLHDC7B Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: KLHDC7B Antibody [NBP3-17596] - Staining of human cell line hTCEpi shows localization to plasma membrane.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KLHDC7B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AAVMRYNTVTGSWSRAASLPLPAPAPLHCTTLGNTIYCLNPQVTATFTVSGGTAQFQAKELQPFPLGSTGVLSPFILTLPPEDRLQTS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KLHDC7B
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence, PFA/Triton X-100 is recommended for fixation/permeabilization.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for KLHDC7B Antibody

  • kelch domain containing 7B
  • kelch domain-containing protein 7B
  • MGC16635

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00002523-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP3-17596
Species: Hu
Applications: ICC/IF

Publications for KLHDC7B Antibody (NBP3-17596) (0)

There are no publications for KLHDC7B Antibody (NBP3-17596).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KLHDC7B Antibody (NBP3-17596) (0)

There are no reviews for KLHDC7B Antibody (NBP3-17596). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for KLHDC7B Antibody (NBP3-17596) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KLHDC7B Products

Array NBP3-17596

Bioinformatics Tool for KLHDC7B Antibody (NBP3-17596)

Discover related pathways, diseases and genes to KLHDC7B Antibody (NBP3-17596). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KLHDC7B Antibody (NBP3-17596)

Discover more about diseases related to KLHDC7B Antibody (NBP3-17596).

Blogs on KLHDC7B

There are no specific blogs for KLHDC7B, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KLHDC7B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KLHDC7B