KLC4 Antibody - BSA Free

Western Blot: KLC4 Antibody [NBP1-88773] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-297

Immunohistochemistry-Paraffin: KLC4 Antibody [NBP1-88773] - Staining of human Small intestine shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: KLC4 Antibody [NBP1-88773] - Staining of human duodenum shows high expression.

Immunohistochemistry-Paraffin: KLC4 Antibody [NBP1-88773] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: KLC4 Antibody [NBP1-88773] - Staining in human duodenum and pancreas tissues using anti-KLC4 antibody. Corresponding KLC4 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: KLC4 Antibody [NBP1-88773] - Staining of human adrenal gland, colon, kidney and testis using Anti-KLC4 antibody NBP1-88773 (A) shows similar protein distribution across tissues to independent antibody NBP1-88772 (B).

Immunohistochemistry-Paraffin: KLC4 Antibody [NBP1-88773] - Staining of human testis.

Immunohistochemistry-Paraffin: KLC4 Antibody [NBP1-88773] - Staining of human kidney.

Immunohistochemistry-Paraffin: KLC4 Antibody [NBP1-88773] - Staining of human colon.

Immunohistochemistry-Paraffin: KLC4 Antibody [NBP1-88773] - Staining of human adrenal gland.

Immunohistochemistry-Paraffin: KLC4 Antibody [NBP1-88773] - Analysis in human duodenum and tonsil tissues using NBP1-88773 antibody. Corresponding KLC4 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: KLC4 Antibody [NBP1-88773] - Staining of human Duodenum shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: KLC4 Antibody [NBP1-88773] - Staining of human gastrointestinal, kidney, placenta and tonsil using Anti-KLC4 antibody NBP1-88773 (A) shows similar protein distribution across tissues to independent antibody NBP1-88772 (B).

Immunohistochemistry-Paraffin: KLC4 Antibody [NBP1-88773] - Staining of human Kidney shows moderate cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: KLC4 Antibody [NBP1-88773] - Staining of human Placenta shows strong cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: KLC4 Antibody [NBP1-88773] - Staining of human Tonsil shows very weak cytoplasmic positivity in non-germinal center cells.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

KLC4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit KLC4 Antibody - BSA Free (NBP1-88773) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MEVTGFGVTRPGKVPQARMSGLVLGQRDEPAGHRLSQEEILGSTRLVSQGLEALRSEHQAVLQSLSQTIECLQQGGHEEGLVHEKARQLRRSMENIELGLS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KLC4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 1:100-1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  KLC4 Protein (NBP1-88773PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for KLC4 Antibody - BSA Free

• bA387M24.3
• kinesin light chain 4
• kinesin-like 8
• Kinesin-like protein 8
• KLC 4
• KNSL8
• MGC111777

Background

Kinesin is a microtubule-associated force-producing protein that may play a role in organelle transport. Thelight chain may function in coupling of cargo to the heavy chain or in the modulation of its ATPase activity (Bysimilarity)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KLC4