![Western Blot: KLC4 Antibody [NBP1-88772] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-296](http://images.novusbio.com/fullsize/KLC4-Antibody-Western-Blot-NBP1-88772-img0005.jpg "Western Blot: KLC4 Antibody [NBP1-88772] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-296")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ETLEECALRSRRQGTDPISQTKVAELLGESDGRRTSQEGPGDSVKFEGGEDASVAVEWSGDGSGTLQRSGSLGKIRDVLRRSSELLV |
| Predicted Species | Mouse (94%), Rat (95%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | KLC4 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | KLC4 |
![Immunocytochemistry/Immunofluorescence: KLC4 Antibody [NBP1-88772] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.](http://images.novusbio.com/fullsize/KLC4-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88772-img0007.jpg "Immunocytochemistry/Immunofluorescence: KLC4 Antibody [NBP1-88772] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.")
![Immunohistochemistry-Paraffin: KLC4 Antibody [NBP1-88772] - Staining of human Small intestine shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/KLC4-Antibody-Immunohistochemistry-Paraffin-NBP1-88772-img0021.jpg "Immunohistochemistry-Paraffin: KLC4 Antibody [NBP1-88772] - Staining of human Small intestine shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: KLC4 Antibody [NBP1-88772] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/KLC4-Antibody-Immunohistochemistry-Paraffin-NBP1-88772-img0009.jpg "Immunohistochemistry-Paraffin: KLC4 Antibody [NBP1-88772] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry-Paraffin: KLC4 Antibody [NBP1-88772] - Staining in human duodenum and pancreas tissues using anti-KLC4 antibody. Corresponding KLC4 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/KLC4-Antibody-Immunohistochemistry-Paraffin-NBP1-88772-img0010.jpg "Immunohistochemistry-Paraffin: KLC4 Antibody [NBP1-88772] - Staining in human duodenum and pancreas tissues using anti-KLC4 antibody. Corresponding KLC4 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: KLC4 Antibody [NBP1-88772] - Staining of human adrenal gland, colon, kidney and testis using Anti-KLC4 antibody NBP1-88772 (A) shows similar protein distribution across tissues to independent antibody NBP1-88773 (B).](http://images.novusbio.com/fullsize/KLC4-Antibody-Immunohistochemistry-Paraffin-NBP1-88772-img0011.jpg "Immunohistochemistry-Paraffin: KLC4 Antibody [NBP1-88772] - Staining of human adrenal gland, colon, kidney and testis using Anti-KLC4 antibody NBP1-88772 (A) shows similar protein distribution across tissues to independent antibody NBP1-88773 (B).")
![Immunohistochemistry-Paraffin: KLC4 Antibody [NBP1-88772] - Staining of human testis.](http://images.novusbio.com/fullsize/KLC4-Antibody-Immunohistochemistry-Paraffin-NBP1-88772-img0012.jpg "Immunohistochemistry-Paraffin: KLC4 Antibody [NBP1-88772] - Staining of human testis.")
![Immunohistochemistry-Paraffin: KLC4 Antibody [NBP1-88772] - Staining of human colon.](http://images.novusbio.com/fullsize/KLC4-Antibody-Immunohistochemistry-Paraffin-NBP1-88772-img0013.jpg "Immunohistochemistry-Paraffin: KLC4 Antibody [NBP1-88772] - Staining of human colon.")
![Immunohistochemistry-Paraffin: KLC4 Antibody [NBP1-88772] - Staining of human adrenal gland.](http://images.novusbio.com/fullsize/KLC4-Antibody-Immunohistochemistry-Paraffin-NBP1-88772-img0014.jpg "Immunohistochemistry-Paraffin: KLC4 Antibody [NBP1-88772] - Staining of human adrenal gland.")
![Immunohistochemistry-Paraffin: KLC4 Antibody [NBP1-88772] - Staining of human kidney.](http://images.novusbio.com/fullsize/KLC4-Antibody-Immunohistochemistry-Paraffin-NBP1-88772-img0015.jpg "Immunohistochemistry-Paraffin: KLC4 Antibody [NBP1-88772] - Staining of human kidney.")
![Immunohistochemistry-Paraffin: KLC4 Antibody [NBP1-88772] - Analysis in human duodenum and tonsil tissues using NBP1-88772 antibody. Corresponding KLC4 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/KLC4-Antibody-Immunohistochemistry-Paraffin-NBP1-88772-img0016.jpg "Immunohistochemistry-Paraffin: KLC4 Antibody [NBP1-88772] - Analysis in human duodenum and tonsil tissues using NBP1-88772 antibody. Corresponding KLC4 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: KLC4 Antibody [NBP1-88772] - Staining of human Duodenum shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/KLC4-Antibody-Immunohistochemistry-Paraffin-NBP1-88772-img0017.jpg "Immunohistochemistry-Paraffin: KLC4 Antibody [NBP1-88772] - Staining of human Duodenum shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: KLC4 Antibody [NBP1-88772] - Staining of human gastrointestinal, kidney, placenta and tonsil using Anti-KLC4 antibody NBP1-88772 (A) shows similar protein distribution across tissues to independent antibody NBP1-88773 (B).](http://images.novusbio.com/fullsize/KLC4-Antibody-Immunohistochemistry-Paraffin-NBP1-88772-img0018.jpg "Immunohistochemistry-Paraffin: KLC4 Antibody [NBP1-88772] - Staining of human gastrointestinal, kidney, placenta and tonsil using Anti-KLC4 antibody NBP1-88772 (A) shows similar protein distribution across tissues to independent antibody NBP1-88773 (B).")
![Immunohistochemistry-Paraffin: KLC4 Antibody [NBP1-88772] - Staining of human Kidney shows moderate cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/KLC4-Antibody-Immunohistochemistry-Paraffin-NBP1-88772-img0019.jpg "Immunohistochemistry-Paraffin: KLC4 Antibody [NBP1-88772] - Staining of human Kidney shows moderate cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: KLC4 Antibody [NBP1-88772] - Staining of human Placenta shows strong cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/KLC4-Antibody-Immunohistochemistry-Paraffin-NBP1-88772-img0020.jpg "Immunohistochemistry-Paraffin: KLC4 Antibody [NBP1-88772] - Staining of human Placenta shows strong cytoplasmic positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: KLC4 Antibody [NBP1-88772] - Staining of human Tonsil shows very weak cytoplasmic positivity in non-germinal center cells.](http://images.novusbio.com/fullsize/KLC4-Antibody-Immunohistochemistry-Paraffin-NBP1-88772-img0022.jpg "Immunohistochemistry-Paraffin: KLC4 Antibody [NBP1-88772] - Staining of human Tonsil shows very weak cytoplasmic positivity in non-germinal center cells.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")