KIF19 Antibody

Images

 
Immunohistochemistry-Paraffin: KIF19 Antibody [NBP2-57895] - Staining of human placenta shows low expression as expected.
Immunohistochemistry-Paraffin: KIF19 Antibody [NBP2-57895] - Staining of human fallopian tube shows high expression.
Immunohistochemistry-Paraffin: KIF19 Antibody [NBP2-57895] - Staining in human fallopian tube and placenta tissues using anti-KIF19 antibody. Corresponding KIF19 RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KIF19 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SGDSKDQQLMVALRVRPISVAELEEGATLIAHKVDEQMVVLMDPMEDPDDILRAHRSREKSYLFDVAFDFTATQEMVYQ
Specificity
Specificity of human KIF19 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KIF19
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
KIF19 Recombinant Protein Antigen (NBP2-57895PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for KIF19 Antibody

  • FLJ37300
  • KIF19A
  • kinesin family member 19
  • kinesin-like protein KIF19

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for KIF19 Antibody (NBP2-57895) (0)

There are no publications for KIF19 Antibody (NBP2-57895).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIF19 Antibody (NBP2-57895) (0)

There are no reviews for KIF19 Antibody (NBP2-57895). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for KIF19 Antibody (NBP2-57895) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for KIF19 Antibody (NBP2-57895)

Discover related pathways, diseases and genes to KIF19 Antibody (NBP2-57895). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on KIF19

There are no specific blogs for KIF19, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KIF19 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KIF19