KIAA2013 Antibody

Western Blot: KIAA2013 Antibody [NBP2-30733] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunohistochemistry: KIAA2013 Antibody [NBP2-30733] - Staining of human kidney shows strong membranous positivity in tubule cells.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

KIAA2013 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LFRSKVGSRHLVETRGLGLALSPVSRKGLAWRGGVRPGQE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KIAA2013
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  KIAA2013 Protein (NBP2-30733PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for KIAA2013 Antibody

• Uncharacterized Protein KIAA2013

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KIAA2013
• Uniprot:
  • Q8IYS2(Human)