KIAA2013 Antibody


Western Blot: KIAA2013 Antibody [NBP2-30733] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry: KIAA2013 Antibody [NBP2-30733] - Staining of human kidney shows strong membranous positivity in tubule cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

KIAA2013 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: LFRSKVGSRHLVETRGLGLALSPVSRKGLAWRGGVRPGQE
Specificity of human KIAA2013 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
KIAA2013 Protein (NBP2-30733PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for KIAA2013 Antibody

  • Uncharacterized Protein KIAA2013


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for KIAA2013 Antibody (NBP2-30733) (0)

There are no publications for KIAA2013 Antibody (NBP2-30733).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIAA2013 Antibody (NBP2-30733) (0)

There are no reviews for KIAA2013 Antibody (NBP2-30733). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KIAA2013 Antibody (NBP2-30733) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional KIAA2013 Products

Bioinformatics Tool for KIAA2013 Antibody (NBP2-30733)

Discover related pathways, diseases and genes to KIAA2013 Antibody (NBP2-30733). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on KIAA2013

There are no specific blogs for KIAA2013, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our KIAA2013 Antibody and receive a gift card or discount.


Gene Symbol KIAA2013