KIAA1755 Antibody


Immunocytochemistry/ Immunofluorescence: KIAA1755 Antibody [NBP2-14720] - Staining of human cell line BJ shows localization to nucleoli & the Golgi apparatus.
Immunohistochemistry-Paraffin: KIAA1755 Antibody [NBP2-14720] - Staining of human testis shows moderate cytoplasmic positivity in cells of seminiferus ducts.
Immunocytochemistry/ Immunofluorescence: KIAA1755 Antibody [NBP2-14720] - Immunofluorescent staining of human cell line SK-MEL-30 shows localization to nucleoli & vesicles.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

KIAA1755 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LDPFLADLHQASSLLQASIEEFEKADPPGGMQEATRCLSKSKELMEAVLR DPGLLGLQREGGATLARLQHDASRLDFSPDV
Specificity of human KIAA1755 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
KIAA1755 Protein (NBP2-14720PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for KIAA1755 Antibody

  • KIAA1755 KIAA1755
  • RP5-1054A22.3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for KIAA1755 Antibody (NBP2-14720) (0)

There are no publications for KIAA1755 Antibody (NBP2-14720).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIAA1755 Antibody (NBP2-14720) (0)

There are no reviews for KIAA1755 Antibody (NBP2-14720). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for KIAA1755 Antibody (NBP2-14720) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional KIAA1755 Products

KIAA1755 NBP2-14720

Bioinformatics Tool for KIAA1755 Antibody (NBP2-14720)

Discover related pathways, diseases and genes to KIAA1755 Antibody (NBP2-14720). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on KIAA1755

There are no specific blogs for KIAA1755, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our KIAA1755 Antibody and receive a gift card or discount.


Gene Symbol KIAA1755