Novus Biologicals products are now on

KIAA1522 Antibody


Genetic Strategies: Western Blot: KIAA1522 Antibody [NBP2-58457] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.
Immunocytochemistry/ Immunofluorescence: KIAA1522 Antibody [NBP2-58457] - Staining of human cell line U-2 OS shows localization to plasma membrane.
Immunohistochemistry-Paraffin: KIAA1522 Antibody [NBP2-58457] - Staining of human stomach, upper shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, KD
Validated by:

Genetic Strategies


Order Details

KIAA1522 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ASFIFSKGSRKLQLERPVSPETQADLQRNLVAELRSISEQRPPQAPKKSPKAPPPVARKPSVGVPPPASPSYPRAEPLTAPPTNGLPHTQD
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
KIAA1522 Recombinant Protein Antigen (NBP2-58457PEP)

Reactivity Notes

Mouse 84%, Rat 81%

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for KIAA1522 Antibody

  • KIAA1522


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for KIAA1522 Antibody (NBP2-58457) (0)

There are no publications for KIAA1522 Antibody (NBP2-58457).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIAA1522 Antibody (NBP2-58457) (0)

There are no reviews for KIAA1522 Antibody (NBP2-58457). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for KIAA1522 Antibody (NBP2-58457) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our KIAA1522 Antibody and receive a gift card or discount.


Gene Symbol KIAA1522