KIAA1522 Antibody

Western Blot: KIAA1522 Antibody [NBP2-58457] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.

Immunocytochemistry/Immunofluorescence: KIAA1522 Antibody [NBP2-58457] - Staining of human cell line U-2 OS shows localization to plasma membrane.

Immunohistochemistry-Paraffin: KIAA1522 Antibody [NBP2-58457] - Staining of human stomach, upper shows strong cytoplasmic and membranous positivity in glandular cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, IHC-P, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

KIAA1522 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ASFIFSKGSRKLQLERPVSPETQADLQRNLVAELRSISEQRPPQAPKKSPKAPPPVARKPSVGVPPPASPSYPRAEPLTAPPTNGLPHTQD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KIAA1522
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  KIAA1522 Recombinant Protein Antigen (NBP2-58457PEP)

Reactivity Notes

Mouse 84%, Rat 81%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for KIAA1522 Antibody

• KIAA1522

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KIAA1522