![Immunohistochemistry-Paraffin: KIAA0753/MNR Antibody [NBP1-90931] - Staining of human cerebral cortex, fallopian tube, kidney and testis using Anti-KIAA0753 antibody NBP1-90931 (A) shows similar protein distribution across tissues to independent antibody NBP1-90929 (B).](http://images.novusbio.com/fullsize/KIAA0753-MNR-Antibody-Immunohistochemistry-Paraffin-NBP1-90931-img0015.jpg "Immunohistochemistry-Paraffin: KIAA0753/MNR Antibody [NBP1-90931] - Staining of human cerebral cortex, fallopian tube, kidney and testis using Anti-KIAA0753 antibody NBP1-90931 (A) shows similar protein distribution across tissues to independent antibody NBP1-90929 (B).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit KIAA0753/MNR Antibody - BSA Free (NBP1-90931) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-KIAA0753/MNR Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PCNGNSLDESVGTEEGSEKREAPLLSLAEDSQQKEGRAPLFVPPGMQHSIGDYCSRFEQYLRIISHEAVGSFNPWLIAESFSEELVDEALGAVAAELQDMCEDYAEAVFTSE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | KIAA0753 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publication using NBP1-90931 | Applications | Species |
|---|---|---|
| Jakobsen L, Vanselow K, Skogs M et al. Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods. EMBO J 2011-04-01 [PMID: 21399614] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | KIAA0753 |
![Western Blot: KIAA0753/MNR Antibody [NBP1-90931] - Analysis using Anti-KIAA0753 antibody NBP1-90931 (A) shows similar pattern to independent antibody NBP1-90929 (B).](http://images.novusbio.com/fullsize/KIAA0753-MNR-Antibody-Western-Blot-NBP1-90931-img0009.jpg "Western Blot: KIAA0753/MNR Antibody [NBP1-90931] - Analysis using Anti-KIAA0753 antibody NBP1-90931 (A) shows similar pattern to independent antibody NBP1-90929 (B).")
![Immunocytochemistry/Immunofluorescence: KIAA0753/MNR Antibody [NBP1-90931] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol & centrosome.](http://images.novusbio.com/fullsize/KIAA0753-MNR-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90931-img0007.jpg "Immunocytochemistry/Immunofluorescence: KIAA0753/MNR Antibody [NBP1-90931] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol & centrosome.")
![Immunohistochemistry-Paraffin: KIAA0753/MNR Antibody [NBP1-90931] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.](http://images.novusbio.com/fullsize/KIAA0753-MNR-Antibody-Immunohistochemistry-Paraffin-NBP1-90931-img0018.jpg "Immunohistochemistry-Paraffin: KIAA0753/MNR Antibody [NBP1-90931] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.")
![Immunohistochemistry-Paraffin: KIAA0753/MNR Antibody [NBP1-90931] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/KIAA0753-MNR-Antibody-Immunohistochemistry-Paraffin-NBP1-90931-img0014.jpg "Immunohistochemistry-Paraffin: KIAA0753/MNR Antibody [NBP1-90931] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: KIAA0753/MNR Antibody [NBP1-90931] - Staining of human Fallopian tube shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/KIAA0753-MNR-Antibody-Immunohistochemistry-Paraffin-NBP1-90931-img0016.jpg "Immunohistochemistry-Paraffin: KIAA0753/MNR Antibody [NBP1-90931] - Staining of human Fallopian tube shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: KIAA0753/MNR Antibody [NBP1-90931] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/KIAA0753-MNR-Antibody-Immunohistochemistry-Paraffin-NBP1-90931-img0017.jpg "Immunohistochemistry-Paraffin: KIAA0753/MNR Antibody [NBP1-90931] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")