Keratinocyte Differentiation Factor 1 Antibody


Immunocytochemistry/ Immunofluorescence: C1orf172 Antibody [NBP2-57750] - Staining of human cell line A-431 shows localization to nucleoplasm, mitotic spindle & cell junctions.

Product Details

Reactivity Hu, RtSpecies Glossary
Applications ICC/IF

Order Details

Keratinocyte Differentiation Factor 1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ANWAKEHNGVPPSPDRAPPSRRDGQRLKSTMGSSFSYPDVKLKGIPVYPYPRATSPAPDADSCCKEPLADPPPMRHSL
Specificity of human C1orf172 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Keratinocyte Differentiation Factor 1 Recombinant Protein Antigen (NBP2-57750PEP)

Reactivity Notes

Mouse 88%

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for Keratinocyte Differentiation Factor 1 Antibody

  • chromosome 1 open reading frame 172
  • RP11-344H11.3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Keratinocyte Differentiation Factor 1 Antibody (NBP2-57750) (0)

There are no publications for Keratinocyte Differentiation Factor 1 Antibody (NBP2-57750).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Keratinocyte Differentiation Factor 1 Antibody (NBP2-57750) (0)

There are no reviews for Keratinocyte Differentiation Factor 1 Antibody (NBP2-57750). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Keratinocyte Differentiation Factor 1 Antibody (NBP2-57750) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional Keratinocyte Differentiation Factor 1 Products

Bioinformatics Tool for Keratinocyte Differentiation Factor 1 Antibody (NBP2-57750)

Discover related pathways, diseases and genes to Keratinocyte Differentiation Factor 1 Antibody (NBP2-57750). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on Keratinocyte Differentiation Factor 1

There are no specific blogs for Keratinocyte Differentiation Factor 1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Keratinocyte Differentiation Factor 1 Antibody and receive a gift card or discount.


Gene Symbol C1orf172