![Western Blot: Keratinocyte Differentiation Factor 1 Antibody [NBP1-93838] - Analysis in human cell line A-431.](http://images.novusbio.com/fullsize/Keratinocyte-Differentiation-Factor-1-Antibody-Western-Blot-NBP1-93838-img0005.jpg "Western Blot: Keratinocyte Differentiation Factor 1 Antibody [NBP1-93838] - Analysis in human cell line A-431.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LDEQDAEGRLVRGIIRISTRKSRARPQTSEGRSTRAAAPTAAAPDSGHETMVGSGLSQDELTVQISQETTADAIARKLRPYGA |
| Predicted Species | Rat (94%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | KDF1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-93838 | Applications | Species |
|---|---|---|
| Lee S, Kong Y, Weatherbee SD. Forward genetics identifies Kdf1/1810019J16Rik as an essential regulator of the proliferation-differentiation decision in epidermal progenitor cells. Dev Biol 2013-11-15 [PMID: 24075906] (IF/IHC, Mouse) | IF/IHC | Mouse |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | KDF1 |
![Immunohistochemistry-Paraffin: Keratinocyte Differentiation Factor 1 Antibody [NBP1-93838] - Staining of human Stomach shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/Keratinocyte-Differentiation-Factor-1-Antibody-Immunohistochemistry-Paraffin-NBP1-93838-img0008.jpg "Immunohistochemistry-Paraffin: Keratinocyte Differentiation Factor 1 Antibody [NBP1-93838] - Staining of human Stomach shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Keratinocyte Differentiation Factor 1 Antibody [NBP1-93838] - Staining of human Cerebral cortex shows no positivity in neuronal cells as expected.](http://images.novusbio.com/fullsize/Keratinocyte-Differentiation-Factor-1-Antibody-Immunohistochemistry-Paraffin-NBP1-93838-img0006.jpg "Immunohistochemistry-Paraffin: Keratinocyte Differentiation Factor 1 Antibody [NBP1-93838] - Staining of human Cerebral cortex shows no positivity in neuronal cells as expected.")
![Immunohistochemistry-Paraffin: Keratinocyte Differentiation Factor 1 Antibody [NBP1-93838] - Staining of human Skin shows moderate cytoplasmic positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/Keratinocyte-Differentiation-Factor-1-Antibody-Immunohistochemistry-Paraffin-NBP1-93838-img0007.jpg "Immunohistochemistry-Paraffin: Keratinocyte Differentiation Factor 1 Antibody [NBP1-93838] - Staining of human Skin shows moderate cytoplasmic positivity in squamous epithelial cells.")
![Immunohistochemistry-Paraffin: Keratinocyte Differentiation Factor 1 Antibody [NBP1-93838] - Staining of human Urinary bladder shows moderate cytoplasmic positivity in urothelial cells.](http://images.novusbio.com/fullsize/Keratinocyte-Differentiation-Factor-1-Antibody-Immunohistochemistry-Paraffin-NBP1-93838-img0009.jpg "Immunohistochemistry-Paraffin: Keratinocyte Differentiation Factor 1 Antibody [NBP1-93838] - Staining of human Urinary bladder shows moderate cytoplasmic positivity in urothelial cells.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")