KCTD18 Antibody

Images

 
Immunohistochemistry-Paraffin: KCTD18 Antibody [NBP1-92044] - Staining of human cerebellum shows strong cytoplasmic and nucleolar positivity in Purkinje cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KCTD18 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LGGRIHSKGIFKREAGNNVQYIWSYYSVAELKKMMDAFDAWEGKGVSYWRVPHELIECWTLEERPLLGSLRHMAPIRKRRLITFNEADESVNYKTGPK
Predicted Species
Mouse (92%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KCTD18
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
KCTD18 Protein (NBP1-92044PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KCTD18 Antibody

  • BTB/POZ domain-containing protein KCTD18
  • FLJ31322
  • FLJ37818
  • potassium channel tetramerisation domain containing 18,6530404F10Rik

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for KCTD18 Antibody (NBP1-92044) (0)

There are no publications for KCTD18 Antibody (NBP1-92044).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KCTD18 Antibody (NBP1-92044) (0)

There are no reviews for KCTD18 Antibody (NBP1-92044). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for KCTD18 Antibody (NBP1-92044) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional KCTD18 Products

Bioinformatics Tool for KCTD18 Antibody (NBP1-92044)

Discover related pathways, diseases and genes to KCTD18 Antibody (NBP1-92044). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on KCTD18

There are no specific blogs for KCTD18, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KCTD18 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KCTD18