![Western Blot: HPF1 Antibody [NBP1-93973] - Analysis in human cell line MOLT-4.](http://images.novusbio.com/fullsize/HPF1-Antibody-Western-Blot-NBP1-93973-img0013.jpg "Western Blot: HPF1 Antibody [NBP1-93973] - Analysis in human cell line MOLT-4.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, Simple Western, ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LVGPYDILAGKHKTKKKSTGLNFNLHWRFYYDPPEFQTIIIGDNKTQYHMGYFRDSPDEFPVYVGINEAKKNCIIVPNGDNVFAA |
| Predicted Species | Mouse (92%), Rat (91%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | C4orf27 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. See Simple Western Antibody Database for Simple Western validation: Tested in MOLT-4 lysate(s), separated by Size, antibody dilution of 1:25, apparent MW was 47 kDa. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | C4orf27 |
![Immunocytochemistry/Immunofluorescence: HPF1 Antibody [NBP1-93973] - Staining of human cell line U-251 shows localization to nucleoli, nucleoplasm and cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/HPF1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-93973-img0012.jpg "Immunocytochemistry/Immunofluorescence: HPF1 Antibody [NBP1-93973] - Staining of human cell line U-251 shows localization to nucleoli, nucleoplasm and cytosol. Antibody staining is shown in green.")
![Simple Western: HPF1 Antibody [NBP1-93973] - Simple Western lane view shows a specific band for C4orf27 in 0.2 mg/ml of MOLT-4 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://images.novusbio.com/fullsize/HPF1-Antibody-Simple-Western-NBP1-93973-img0006.jpg "Simple Western: HPF1 Antibody [NBP1-93973] - Simple Western lane view shows a specific band for C4orf27 in 0.2 mg/ml of MOLT-4 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.")
![Simple Western: HPF1 Antibody [NBP1-93973] - Electropherogram image of the corresponding Simple Western lane view. C4orf27 antibody was used at 1:25 dilution on MOLT-4 lysate(s) respectively.](http://images.novusbio.com/fullsize/HPF1-Antibody-Simple-Western-NBP1-93973-img0007.jpg "Simple Western: HPF1 Antibody [NBP1-93973] - Electropherogram image of the corresponding Simple Western lane view. C4orf27 antibody was used at 1:25 dilution on MOLT-4 lysate(s) respectively.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")