Recombinant Human HOXC13 Protein

Images

 
SDS-Page: Recombinant Human HOXC13 Protein [H00003229-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human HOXC13 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 132-231 of Human HOXC13

Source: Wheat Germ

Amino Acid Sequence: CRLSHNVNLQQKPCAYHPGDKYPEPSGALPGDDLSSRAKEFAFYPSFASSYQAMPGYLDVSVVPGISGHPEPRHDALIPVEGYQHWALSNGWDSQVYCSK

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
HOXC13
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HOXC13 Protein

  • homeo box 3G
  • homeo box C13
  • homeobox C13
  • Homeobox protein Hox-3G
  • homeobox protein Hox-C13
  • HOX3
  • HOX3GNUP98/HOXC13

Background

HOXC13 - homeo box C13

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7295
Species: Mu
Applications: IHC
NBP2-32356
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45744
Species: Hu
Applications: WB, IHC
NBP1-86960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003209-Q01
Species: Hu
H00003237-M10
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-46000
Species: Hu
Applications: WB, IHC
NB100-93325
Species: Hu
Applications: WB, IP
NBP2-55738
Species: Hu
Applications: ICC/IF
NBP2-49631
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00003232-M09
Species: Hu
Applications: WB, ELISA, ICC/IF
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-45603
Species: Hu
Applications: WB, Flow, IHC
NBP2-58710
Species: Hu
Applications: WB, ICC/IF
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27108
Species: Hu, Mu, Pm
Applications: WB
NBP1-52149
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP2-43834
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003886-P01
Species: Hu

Publications for HOXC13 Partial Recombinant Protein (H00003229-Q01) (0)

There are no publications for HOXC13 Partial Recombinant Protein (H00003229-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXC13 Partial Recombinant Protein (H00003229-Q01) (0)

There are no reviews for HOXC13 Partial Recombinant Protein (H00003229-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HOXC13 Partial Recombinant Protein (H00003229-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for HOXC13 Partial Recombinant Protein (H00003229-Q01)

Discover related pathways, diseases and genes to HOXC13 Partial Recombinant Protein (H00003229-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXC13 Partial Recombinant Protein (H00003229-Q01)

Discover more about diseases related to HOXC13 Partial Recombinant Protein (H00003229-Q01).
 

Pathways for HOXC13 Partial Recombinant Protein (H00003229-Q01)

View related products by pathway.

PTMs for HOXC13 Partial Recombinant Protein (H00003229-Q01)

Learn more about PTMs related to HOXC13 Partial Recombinant Protein (H00003229-Q01).

Blogs on HOXC13

There are no specific blogs for HOXC13, but you can read our latest blog posts.

Customers Who Bought This Also Bought

LEF1 Antibody
NBP1-86960
HOXC13 Antibody
NBP2-47428
HOXA9 Antibody
NBP2-32356

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HOXC13 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXC13