Recombinant Human Histone H3.1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Histone H3.1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-136 of Human HIST1H3E full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
HIST1H3E

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Histone H3.1 Protein

  • H3 histone family, member D
  • H3.1HIST1H3D
  • H3/d
  • H3FA
  • H3FB
  • H3FC
  • H3FDHIST1H3F
  • H3FF
  • H3FH
  • H3FI
  • H3FJ
  • H3FK
  • H3FL
  • HIST1H3A
  • HIST1H3B
  • HIST1H3C
  • HIST1H3G
  • HIST1H3H
  • HIST1H3I
  • HIST1H3J
  • histone 1, H3e
  • histone cluster 1, H3e
  • histone H3.1
  • Histone H3/a
  • Histone H3/b
  • Histone H3/c
  • Histone H3/d
  • Histone H3/f
  • Histone H3/h
  • Histone H3/i
  • Histone H3/j
  • Histone H3/k
  • Histone H3/l

Background

HIST1H3E( AAH52981, 1 a.a. - 137 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB21-1023
Species: Hu, Mu, Ce
Applications: WB, ChIP, DB, ICC/IF
NBP2-07996
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-90058
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00008349-M06
Species: Hu
Applications: ELISA, IHC-P
NBP1-58095
Species: Hu
Applications: WB
NBP2-61489
Species: Hu, Vb
Applications: WB, ELISA, ICC/IF
NBL1-11569
Species: Hu
NB21-2024
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF
H00008360-R01
Species: Hu
NBL1-11570
Species: Hu
NBP2-10888
Species: Hu
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF
NBL1-11567
Species: Hu
NB100-56346
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
H00003021-M01
Species: Hu, Mu, Xp
Applications: WB, ELISA, ICC/IF, IHC-P, KO
NBP2-12892
Species: Hu
Applications: WB, ICC/IF
NB500-212
Species: Hu
Applications: WB, ICC/IF, IP

Publications for Histone H3.1 Recombinant Protein (H00008353-P01) (0)

There are no publications for Histone H3.1 Recombinant Protein (H00008353-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Histone H3.1 Recombinant Protein (H00008353-P01) (0)

There are no reviews for Histone H3.1 Recombinant Protein (H00008353-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Histone H3.1 Recombinant Protein (H00008353-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Histone H3.1 Products

Bioinformatics Tool for Histone H3.1 Recombinant Protein (H00008353-P01)

Discover related pathways, diseases and genes to Histone H3.1 Recombinant Protein (H00008353-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Histone H3.1 Recombinant Protein (H00008353-P01)

Discover more about diseases related to Histone H3.1 Recombinant Protein (H00008353-P01).
 

Pathways for Histone H3.1 Recombinant Protein (H00008353-P01)

View related products by pathway.

PTMs for Histone H3.1 Recombinant Protein (H00008353-P01)

Learn more about PTMs related to Histone H3.1 Recombinant Protein (H00008353-P01).
 

Research Areas for Histone H3.1 Recombinant Protein (H00008353-P01)

Find related products by research area.

Blogs on Histone H3.1.

H3.1 - A core histone essential for genome storage and organization
Histones are the main protein component of chromatin and are essential for the storage and compaction of the genome. DNA wraps around histone oligomers to make up nucleosomes, the individual subunits of chromatin. By altering the accessibility of t...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Histone H3.1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HIST1H3E