HIGD2A Antibody


Western Blot: HIGD2A Antibody [NBP2-14092] - Analysis in human cell line HEK 293.
Immunocytochemistry/ Immunofluorescence: HIGD2A Antibody [NBP2-14092] - Immunofluorescent staining of human cell line MCF7 shows localization to cytosol & mitochondria.
Immunohistochemistry-Paraffin: HIGD2A Antibody [NBP2-14092] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: HIGD2A Antibody [NBP2-14092] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

HIGD2A Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: PFEPSKPPVIEGLSPTVYRNPESFKEKFVRKTREN
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HIGD2A Protein (NBP2-14092PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (83%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for HIGD2A Antibody

  • HIG1 domain family member 2A
  • HIG1 domain family, member 2A
  • HIG1 hypoxia inducible domain family, member 2A
  • MGC2198


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HIGD2A Antibody (NBP2-14092) (0)

There are no publications for HIGD2A Antibody (NBP2-14092).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HIGD2A Antibody (NBP2-14092) (0)

There are no reviews for HIGD2A Antibody (NBP2-14092). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HIGD2A Antibody (NBP2-14092) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional HIGD2A Products

Bioinformatics Tool for HIGD2A Antibody (NBP2-14092)

Discover related pathways, diseases and genes to HIGD2A Antibody (NBP2-14092). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on HIGD2A

There are no specific blogs for HIGD2A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our HIGD2A Antibody and receive a gift card or discount.


Gene Symbol HIGD2A