Recombinant Human HGSNAT Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human HGSNAT Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 206 of Human HGSNAT full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MALGLCRCFHPRHSMAAFGLFPALPSALNSHPACTCLLDPSTWRPAHVSGPALASSPQILSVFSLGFPGFVNGSCVSRYKPDIIFPPGLPPPDLPSSVSIFYLQLLCSHGHCCITESGPLLSFSNWPPSLVPHFLKSPVHCHQIKLSPARSPLSEKPPLTWKHHCLAHILTYSPSRLDPHTSFQPPLPLHSLLPPPPPHPLVSPPL

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
HGSNAT
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
48.7 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HGSNAT Protein

  • heparan-alpha-glucosaminide N-acetyltransferase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-31555
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-83164
Species: Hu
Applications: WB, IHC, IHC-P
AF2484
Species: Hu
Applications: WB, IP
NBP2-24716
Species: Hu, Mu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
H00257054-P01
Species: Hu

Publications for HGSNAT Recombinant Protein (H00138050-P01) (0)

There are no publications for HGSNAT Recombinant Protein (H00138050-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HGSNAT Recombinant Protein (H00138050-P01) (0)

There are no reviews for HGSNAT Recombinant Protein (H00138050-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HGSNAT Recombinant Protein (H00138050-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional HGSNAT Products

Array H00138050-P01

Bioinformatics Tool for HGSNAT Recombinant Protein (H00138050-P01)

Discover related pathways, diseases and genes to HGSNAT Recombinant Protein (H00138050-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HGSNAT Recombinant Protein (H00138050-P01)

Discover more about diseases related to HGSNAT Recombinant Protein (H00138050-P01).
 

Pathways for HGSNAT Recombinant Protein (H00138050-P01)

View related products by pathway.

PTMs for HGSNAT Recombinant Protein (H00138050-P01)

Learn more about PTMs related to HGSNAT Recombinant Protein (H00138050-P01).

Blogs on HGSNAT

There are no specific blogs for HGSNAT, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HGSNAT Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HGSNAT
COVID-19 update