HDHD3 Antibody

Images

 
Western Blot: HDHD3 Antibody [NBP1-86707] - Analysis in control (vector only transfected HEK293T lysate) and HDHD3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: HDHD3 Antibody [NBP1-86707] - Staining of human lymph node.
Immunohistochemistry-Paraffin: HDHD3 Antibody [NBP1-86707] - Staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.
Independent Antibodies: Immunohistochemistry-Paraffin: HDHD3 Antibody [NBP1-86707] - Staining of human colon, liver, lymph node and parathyroid gland using Anti-HDHD3 antibody NBP1-86707 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: HDHD3 Antibody [NBP1-86707] - Staining of human liver.
Immunohistochemistry-Paraffin: HDHD3 Antibody [NBP1-86707] - Staining of human parathyroid gland.
Immunohistochemistry-Paraffin: HDHD3 Antibody [NBP1-86707] - Staining of human colon.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

HDHD3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LQTFHLAGVQDAQAVAPIAEQLYKDFSHPCTWQVLDGAEDTLRECRTRGLRLAVISNFDRRLEGILGGLGLREHFDFVLTSEAAGW
Specificity
Specificity of human HDHD3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HDHD3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
IHC reported in scientific literature (PMID: 25314065). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HDHD3 Protein (NBP1-86707PEP)
Publications
Read Publication using
NBP1-86707 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25314065).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HDHD3 Antibody

  • C9orf158
  • chromosome 9 open reading frame 158,2810435D12Rik
  • haloacid dehalogenase-like hydrolase domain containing 3
  • haloacid dehalogenase-like hydrolase domain-containing protein 3
  • MGC12904

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HDHD3 Antibody (NBP1-86707)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for HDHD3 Antibody (NBP1-86707) (0)

There are no reviews for HDHD3 Antibody (NBP1-86707). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HDHD3 Antibody (NBP1-86707) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional HDHD3 Products

Bioinformatics Tool for HDHD3 Antibody (NBP1-86707)

Discover related pathways, diseases and genes to HDHD3 Antibody (NBP1-86707). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for HDHD3 Antibody (NBP1-86707)

Find related products by research area.

Blogs on HDHD3

There are no specific blogs for HDHD3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HDHD3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HDHD3