We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

HDHD3 Antibody - BSA Free

Images

 
Staining of human cell line MCF7 shows localization to nucleoli.
Independent Antibodies: Immunohistochemistry-Paraffin: HDHD3 Antibody [NBP1-86706] - Staining of human colon, liver, lymph node and parathyroid gland using Anti-HDHD3 antibody NBP1-86706 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: HDHD3 Antibody [NBP1-86706] - Staining of human lymph node.
Immunohistochemistry-Paraffin: HDHD3 Antibody [NBP1-86706] - Staining of human colon.
Immunohistochemistry-Paraffin: HDHD3 Antibody [NBP1-86706] - Staining of human liver.
Immunohistochemistry-Paraffin: HDHD3 Antibody [NBP1-86706] - Staining of human parathyroid gland.
Western Blot: HDHD3 Antibody [NBP1-86706] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Validated by:
 

Independent Antibodies

       

Order Details

View Available Formulations
Catalog# & Formulation Size Price

HDHD3 Antibody - BSA Free Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MAHRLQIRLLTWDVKDTLLRLRHPLGEAYATKARAHGLEVEPSALEQGFRQAYRAQSHSFPNYGLSHGLTSRQWWLDVV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HDHD3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20-1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HDHD3 Protein (NBP1-86706PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for HDHD3 Antibody - BSA Free

  • C9orf158
  • chromosome 9 open reading frame 158,2810435D12Rik
  • haloacid dehalogenase-like hydrolase domain containing 3
  • haloacid dehalogenase-like hydrolase domain-containing protein 3
  • MGC12904

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HDHD3 Antibody (NBP1-86706) (0)

There are no publications for HDHD3 Antibody (NBP1-86706).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HDHD3 Antibody (NBP1-86706) (0)

There are no reviews for HDHD3 Antibody (NBP1-86706). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HDHD3 Antibody (NBP1-86706) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HDHD3 Products

Research Areas for HDHD3 Antibody (NBP1-86706)

Find related products by research area.

Blogs on HDHD3

There are no specific blogs for HDHD3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HDHD3 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol HDHD3