HD domain containing 2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: HD domain containing 2 Antibody [NBP1-88251] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & nucleoli.
Immunohistochemistry-Paraffin: HD domain containing 2 Antibody [NBP1-88251] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HD domain containing 2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MASVSSATFSGHGARSLLQFLLLVGQLKRVPRTGWVYRNVQRPESVSDHMYRMAVMAMVIKDDRLNKDRCVRLALVHDMAECIVGDIAPADNIPKEEKHRREEEAMKQITQLLP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HDDC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HD domain containing 2 Protein (NBP1-88251PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HD domain containing 2 Antibody

  • C6orf74
  • CGI-130
  • chromosome 6 open reading frame 74
  • dJ167O5.2
  • HCV NS5A-transactivated protein 2
  • HD domain containing 2
  • HD domain-containing protein 2
  • Hepatitis C virus NS5A-transactivated protein 2
  • MGC87330
  • NS5ATP2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HD domain containing 2 Antibody (NBP1-88251) (0)

There are no publications for HD domain containing 2 Antibody (NBP1-88251).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HD domain containing 2 Antibody (NBP1-88251) (0)

There are no reviews for HD domain containing 2 Antibody (NBP1-88251). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for HD domain containing 2 Antibody (NBP1-88251) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HD domain containing 2 Products

Bioinformatics Tool for HD domain containing 2 Antibody (NBP1-88251)

Discover related pathways, diseases and genes to HD domain containing 2 Antibody (NBP1-88251). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on HD domain containing 2

There are no specific blogs for HD domain containing 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HD domain containing 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HDDC2