GVQW1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: GVQW1 Antibody [NBP2-57676] - Staining of human cell line SH-SY5Y shows localization to mitochondria.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GVQW1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: STPGVLCKTGMGREPIPETQCHFANSMCSLHVSVPYFGNSPNISNFFRWSLALS
Specificity
Specificity of human GVQW1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GVQW1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GVQW1 Recombinant Protein Antigen (NBP2-57676PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for GVQW1 Antibody

  • BA205M20.5
  • GVQW Motif Containing 1
  • GVQW Motif-Containing Protein 1
  • TIGD1L2
  • Tigger Transposable Element Derived 1-Like 2
  • Tigger Transposable Element-Derived 1-Like Protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GVQW1 Antibody (NBP2-57676) (0)

There are no publications for GVQW1 Antibody (NBP2-57676).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GVQW1 Antibody (NBP2-57676) (0)

There are no reviews for GVQW1 Antibody (NBP2-57676). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GVQW1 Antibody (NBP2-57676) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional GVQW1 Products

Array NBP2-57676

Bioinformatics Tool for GVQW1 Antibody (NBP2-57676)

Discover related pathways, diseases and genes to GVQW1 Antibody (NBP2-57676). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on GVQW1

There are no specific blogs for GVQW1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GVQW1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GVQW1