GRXCR2 Antibody


Immunohistochemistry-Paraffin: GRXCR2 Antibody [NBP2-32458] - Staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: GRXCR2 Antibody [NBP2-32458] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry-Paraffin: GRXCR2 Antibody [NBP2-32458] - Staining of human testis shows weak cytoplasmic positivity in peritubular myoid cells.
Immunohistochemistry-Paraffin: GRXCR2 Antibody [NBP2-32458] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

GRXCR2 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: KSDGKPRKVRFKISSSYSGRVLKQVFEDGQELESPKEEYPHSFLQESLETMDGVYGSGEVPRPQMCSPKL
Specificity of human GRXCR2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GRXCR2 Recombinant Protein Antigen (NBP2-32458PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for GRXCR2 Antibody

  • Glutaredoxin Domain-Containing Cysteine-Rich Protein 1-Like Protein
  • Glutaredoxin Domain-Containing Cysteine-Rich Protein 2
  • Glutaredoxin, Cysteine Rich 2
  • GRXCR1-Like Protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GRXCR2 Antibody (NBP2-32458) (0)

There are no publications for GRXCR2 Antibody (NBP2-32458).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GRXCR2 Antibody (NBP2-32458) (0)

There are no reviews for GRXCR2 Antibody (NBP2-32458). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GRXCR2 Antibody (NBP2-32458) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional GRXCR2 Products

Bioinformatics Tool for GRXCR2 Antibody (NBP2-32458)

Discover related pathways, diseases and genes to GRXCR2 Antibody (NBP2-32458). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on GRXCR2

There are no specific blogs for GRXCR2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GRXCR2 Antibody and receive a gift card or discount.


Gene Symbol GRXCR2