GRPEL2 Antibody

Images

 
Western Blot: GRPEL2 Antibody [NBP1-54666] - Human Heart lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GRPEL2 Antibody Summary

Immunogen
Synthetic peptides corresponding to GRPEL2(GrpE-like 2, mitochondrial (E. coli)) The peptide sequence was selected from the middle region of GRPEL2. Peptide sequence HEHELICHVPAGVGVQPGTVALVRQDGYKLHGRTIRLARVEVAVESQRRL. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GRPEL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against GRPEL2 and was validated on Western blot.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GRPEL2 Antibody

  • FLJ23713
  • FLJ33918
  • GrpE-like 2, mitochondrial (E. coli)
  • Mt-GrpE#2mitochondrial

Background

GRPEL2 is an essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. GRPEL2 seems to control the nucleotide-dependent binding of mitochondrial HSP70 to substrate proteins. GRPEL2 stimulates ATPase activity of mt-HSP70. GRPEL2 may also serve to modulate the interconversion of oligomeric (inactive) and monomeric (active) forms of mt-HSP70.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83557
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67817
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB

Publications for GRPEL2 Antibody (NBP1-54666) (0)

There are no publications for GRPEL2 Antibody (NBP1-54666).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GRPEL2 Antibody (NBP1-54666) (0)

There are no reviews for GRPEL2 Antibody (NBP1-54666). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GRPEL2 Antibody (NBP1-54666) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GRPEL2 Products

Bioinformatics Tool for GRPEL2 Antibody (NBP1-54666)

Discover related pathways, diseases and genes to GRPEL2 Antibody (NBP1-54666). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on GRPEL2

There are no specific blogs for GRPEL2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GRPEL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GRPEL2
Uniprot