GRK5 Antibody


Western Blot: GRK5 Antibody [NBP1-58325] - Lanes: Lanes 1-3: 40 ug tobacco hornworm larvae intestine lysate Primary Antibody Dilution: 1 : 1000 Secondary Antibody: Goat anti-rabbit HRP Secondary Antibody Dilution: 1 : more
Immunohistochemistry: GRK5 Antibody [NBP1-58325] - GRK5 Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue Observed Staining: Cytoplasm and membrane of alveolar macrophages Primary Antibody Concentration: 1:100 more
Western Blot: GRK5 Antibody [NBP1-58325] - Human Brain lysate, concentration 0.2-1 ug/ml.
Western Blot: GRK5 Antibody [NBP1-58325] - Lanes: Lane1: 1ug human GRK5 protein Lane2: 0.25ug human GRK5 protein Lane3: 0.1ug human GRK5 protein Lane4: 5ug rat striatum homogenate Lane5: 5ug rat striatum cytosol Lane6: more
Western Blot: GRK5 Antibody [NBP1-58325] - Sample Type : Lane 1: 20 ug mouse left ventricle heart lysate Primary Antibody Dilution : 1:1000 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody Dilution: 1:5000 more

Product Details

Reactivity Hu, Mu, InSpecies Glossary
Applications WB, IHC

Order Details

GRK5 Antibody Summary

Synthetic peptides corresponding to GRK5(G protein-coupled receptor kinase 5) The peptide sequence was selected from the middle region of GRK5. Peptide sequence FYAAEILCGLEDLHRENTVYRDLKPENILLDDYGHIRISDLGLAVKIPEG.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against GRK5 and was validated on Western blot.
Positive Control
GRK5 Lysate (NBP2-65165)

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GRK5 Antibody

  • EC 2.7.11
  • EC
  • FLJ39780
  • G protein-coupled receptor kinase 5
  • G protein-coupled receptor kinase GRK5
  • GPRK5
  • GPRK5FP2025
  • GRK5


GRK5 is a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. It has also been shown to play a role in regulating the motility of polymorphonuclear leukocytes (PMNs).This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. It has also been shown to play a role in regulating the motility of polymorphonuclear leukocytes (PMNs). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC-P
Species: Hu
Applications: IHC-P
Species: Hu, Mk
Applications: IHC-P, ICC
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
Species: Hu, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for GRK5 Antibody (NBP1-58325) (0)

There are no publications for GRK5 Antibody (NBP1-58325).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GRK5 Antibody (NBP1-58325) (0)

There are no reviews for GRK5 Antibody (NBP1-58325). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GRK5 Antibody (NBP1-58325) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional GRK5 Products

Bioinformatics Tool for GRK5 Antibody (NBP1-58325)

Discover related pathways, diseases and genes to GRK5 Antibody (NBP1-58325). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GRK5 Antibody (NBP1-58325)

Discover more about diseases related to GRK5 Antibody (NBP1-58325).

Pathways for GRK5 Antibody (NBP1-58325)

View related products by pathway.

PTMs for GRK5 Antibody (NBP1-58325)

Learn more about PTMs related to GRK5 Antibody (NBP1-58325).

Research Areas for GRK5 Antibody (NBP1-58325)

Find related products by research area.

Blogs on GRK5

There are no specific blogs for GRK5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GRK5 Antibody and receive a gift card or discount.


Gene Symbol GRK5