GREB1L Antibody


Immunocytochemistry/ Immunofluorescence: GREB1L Antibody [NBP2-33415] - Staining of human cell line CACO-2 shows localization to nucleoli & mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: GREB1L Antibody [NBP2-33415] - Staining of human lymph node shows strong cytoplasmic positivity in germinal center cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

GREB1L Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: MVNTLLERYPRLHSMVVRCYLLIQQYSEALMALTTMASLRDHSTPETLSIMDDLISSPGKNKSGRGHMLIIRVPSVQLAMLAKER
Specificity of human GREB1L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (94%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GREB1L Protein (NBP2-33415PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for GREB1L Antibody

  • C18orf6
  • GREB1-Like Protein
  • Growth Regulation By Estrogen In Breast Cancer-Like
  • KIAA1772


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GREB1L Antibody (NBP2-33415) (0)

There are no publications for GREB1L Antibody (NBP2-33415).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GREB1L Antibody (NBP2-33415) (0)

There are no reviews for GREB1L Antibody (NBP2-33415). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GREB1L Antibody (NBP2-33415) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional GREB1L Products

Bioinformatics Tool for GREB1L Antibody (NBP2-33415)

Discover related pathways, diseases and genes to GREB1L Antibody (NBP2-33415). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on GREB1L

There are no specific blogs for GREB1L, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GREB1L Antibody and receive a gift card or discount.


Gene Symbol GREB1L