![Western Blot: GRAMD1C Antibody [NBP1-90559] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4.](http://images.novusbio.com/fullsize/GRAMD1C-Antibody-Western-Blot-NBP1-90559-img0005.jpg "Western Blot: GRAMD1C Antibody [NBP1-90559] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VSTDLKYRKQPWGLVKSLIEKNSWSSLEDYFKQLESDLLIEESVLNQAIEDPGKLTGLRRRRRTFNRTAETVPKLSSQHSSGDVGLGAKG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GRAMD1C |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-90559 | Applications | Species |
|---|---|---|
| Laraia L, Friese A, Corkery DP et al. The cholesterol transfer protein GRAMD1A regulates autophagosome biogenesis Nat. Chem. Biol. 2019-07-01 [PMID: 31222192] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | GRAMD1C |
![Immunohistochemistry-Paraffin: GRAMD1C Antibody [NBP1-90559] - Staining of human small intestine shows moderate to strong cytoplasmic positivity in smooth muscle cells.](http://images.novusbio.com/fullsize/GRAMD1C-Antibody-Immunohistochemistry-Paraffin-NBP1-90559-img0008.jpg "Immunohistochemistry-Paraffin: GRAMD1C Antibody [NBP1-90559] - Staining of human small intestine shows moderate to strong cytoplasmic positivity in smooth muscle cells.")
![Immunohistochemistry-Paraffin: GRAMD1C Antibody [NBP1-90559] - Staining of human kidney shows moderate to strong membranous positivity in cells in tubules and cells in glomeruli.](http://images.novusbio.com/fullsize/GRAMD1C-Antibody-Immunohistochemistry-Paraffin-NBP1-90559-img0006.jpg "Immunohistochemistry-Paraffin: GRAMD1C Antibody [NBP1-90559] - Staining of human kidney shows moderate to strong membranous positivity in cells in tubules and cells in glomeruli.")
![Immunohistochemistry-Paraffin: GRAMD1C Antibody [NBP1-90559] - Staining of human testis shows moderate to strong membranous positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/GRAMD1C-Antibody-Immunohistochemistry-Paraffin-NBP1-90559-img0007.jpg "Immunohistochemistry-Paraffin: GRAMD1C Antibody [NBP1-90559] - Staining of human testis shows moderate to strong membranous positivity in cells in seminiferous ducts.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")