GPR176 Antibody - BSA Free

Immunohistochemistry-Paraffin: GPR176 Antibody [NBP1-81819] - Staining of human small intestine shows strong positivity in apical membrane in glandular cells.

Immunohistochemistry-Paraffin: GPR176 Antibody [NBP1-81819] - Staining of human caudate nucleus shows moderate positivity in neuropil.

Immunohistochemistry-Paraffin: GPR176 Antibody [NBP1-81819] - Staining of human prostate shows moderate membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: GPR176 Antibody [NBP1-81819] - Staining of human fallopian tube shows moderate positivity in apical membrane in glandular cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GPR176 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KCLIGTLVQLHHRYSRRNVVSTGSGMAEASLEPSIRSGSQLLEMFHIGQQQIFKPTEDEEESEAKYIGSADFQAKEIFSTCLEGEQGPQFA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GPR176
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  GPR176 Protein (NBP1-81819PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GPR176 Antibody - BSA Free

• G protein-coupled receptor 176
• Gm1012
• GPR
• GPR176
• HB-954
• probable G-protein coupled receptor 176
• putative G protein coupled receptor

Background

The GPR176 gene is a member of the G protein-coupled receptor family and is described as an orphan receptor. It works as cell surface receptors involved in various responses such as to hormones, growth factors, and neurotransmitters. The protein encoded by the GPR176 gene is 515 amino acids long at nearly 57 kDA in mass. GPR176 is involved with GPCRs.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GPR176